PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004392.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 87aa    MW: 9319.38 Da    PI: 9.1025
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004392.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.38.7e-342582260
              ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                             ++vrY eC++NhAa++Gg+avDGC+Efmps g +gtaaal+CaACgCHRnFHRr+v++e
  Itr_sc004392.1_g00001.1 25 TSVRYAECQRNHAANIGGYAVDGCREFMPS-GGDGTAAALTCAACGCHRNFHRRDVQSE 82
                             579**************************9.8899*******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-14183IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.9E-312779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-272878IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.8372978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MKKRQVVVRK DLTRRNTGGV SGATTSVRYA ECQRNHAANI GGYAVDGCRE FMPSGGDGTA  60
AALTCAACGC HRNFHRRDVQ SEVSESS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800036.13e-39PREDICTED: mini zinc finger protein 3-like
SwissprotQ2Q4932e-33MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A059A5783e-38A0A059A578_EUCGR; Uncharacterized protein
STRINGVIT_14s0108g00810.t013e-34(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.12e-22mini zinc finger